PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo14G0014600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 199aa    MW: 21453.2 Da    PI: 8.7541
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo14G0014600genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.61.2e-372785361
           zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                     e++l+cprC+stntkfCyynny+ +qPr+fCkaCrryWt+GG+lrn+PvGg++rkn k+
  Spipo14G0014600 27 ERNLRCPRCESTNTKFCYYNNYNFAQPRHFCKACRRYWTRGGSLRNIPVGGASRKNTKR 85
                     67899***************************************************886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-252684IPR003851Zinc finger, Dof-type
PfamPF027018.2E-322984IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6123084IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MQNPTAEAAA ALLKSNMEAP PRVPAEERNL RCPRCESTNT KFCYYNNYNF AQPRHFCKAC  60
RRYWTRGGSL RNIPVGGASR KNTKRTAATA SSHNKRSVHR AAVFPAAAPA PPPPPPLDAL  120
NVEPVSSLHS STGDIDRLML NATGSFTALL FSEAQFGNLL GSFHEEAPDL ATFDLRSPTD  180
GGAAPPPPPR EVPLPEDF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00199DAPTransfer from AT1G51700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3614722e-37AK361472.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1141F22.
GenBankAK3645832e-37AK364583.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2026L11.
GenBankAY9554932e-37AY955493.2 Triticum aestivum Dof1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009397467.16e-46PREDICTED: dof zinc finger protein DOF3.1-like
TrEMBLM0RLY02e-43M0RLY0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P27560_0016e-43(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.13e-38DOF zinc finger protein 1